Recombinant Cyprinus carpio Parvalbumin(cyp c 1.02)

SKU: CSB-EP2033EQE

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8UUS2

Gene Names: cyp c 1.02

Organism: Cyprinus carpio (Common carp)

AA Sequence: MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA

Expression Region: 1-109aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.6 kDa

Alternative Name(s):

Relevance:

Reference: "Recombinant carp parvalbumin, the major cross-reactive fish allergen: a tool for diagnosis and therapy of fish allergy."Swoboda I., Bugajska-Schretter A., Verdino P., Keller W., Sperr W.R., Valent P., Valenta R., Spitzauer S.J. Immunol. 168:4576-4584(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.