Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. UPF0059 membrane protein cce_3994 (cce_3994)

Recombinant Cyanothece sp. UPF0059 membrane protein cce_3994 (cce_3994)

SKU:CSB-CF542916DZY

Regular price ¥271,000 JPY
Regular price Sale price ¥271,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain ATCC 51142)

Uniprot NO.:B1WQP0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELVNITCLGLGLAADAFAVSLSSGFVIQRIKFNKALKIALFFGIFQAIMPLIGWLTGLS FREFMTNIDHWIAFILLLGIGSKMIYEAYKEMDDDDKFNPLDTYTLLALAIATSIDALAA GLGLSLLKTSILLPCTLIGLITFVLSFIGVFIGHKFGSIFNKKIEIIGGLTLIIIGSKIL IEDLIKPI

Protein Names:Recommended name: UPF0059 membrane protein cce_3994

Gene Names:Ordered Locus Names:cce_3994

Expression Region:1-188

Sequence Info:full length protein

View full details