Recombinant Cyanothece sp. Photosystem II reaction center protein H(psbH)

SKU: CSB-CF476605EPW

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))

Uniprot NO.:B7JW07

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQRTGLGDLLRPLNSEYGKVVPGWGTTPLMGVFMGLFLVFLLIILQIYNSSLILEGFTV TWGG

Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H

Gene Names:Name:psbH Ordered Locus Names:PCC8801_1645

Expression Region:1-64

Sequence Info:full length protein