Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. Photosystem I reaction center subunit XI(psaL)

Recombinant Cyanothece sp. Photosystem I reaction center subunit XI(psaL)

SKU:CSB-CF542914DZY

Regular price ¥268,300 JPY
Regular price Sale price ¥268,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain ATCC 51142)

Uniprot NO.:B1WPZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIIGQRGDPQIGNLATPVNSSRLSLAFIRNLPAYRRGLSANRRGLEVGMAHGYFLYGPF AILGPLRNTEYASTGGLLSAVAMISILTIALSLYASVEVGKPIETLTTPDVPEDLGTSVG WGEFANGFFIGGSGGVIFAYLLCQALYFDLIQKILG

Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L

Gene Names:Name:psaL Ordered Locus Names:cce_3964

Expression Region:1-156

Sequence Info:full length protein

View full details