Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. Cytochrome b6(petB)

Recombinant Cyanothece sp. Cytochrome b6(petB)

SKU:CSB-CF484870DZZ

Regular price ¥280,100 JPY
Regular price Sale price ¥280,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))

Uniprot NO.:B7KHH8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSKQVTDSKVYQWFEERLEVQEIADDITSKYVPPHVNIFYCLGGITLVCFLIQFATGFA MTFYYKPTVTEAFTSVEYIMNEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKP RELTWIVGVIMAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVVGDQMVELLRGGA SVGQTTLTRFYSIHTFVLPWLMAVFMLLHFLMIRKQGISGPL

Protein Names:Recommended name: Cytochrome b6

Gene Names:Name:petB Ordered Locus Names:PCC7424_2251

Expression Region:1-222

Sequence Info:full length protein

View full details