Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cuscuta reflexa ATP synthase subunit C, plastid(atpE)

Recombinant Cuscuta reflexa ATP synthase subunit C, plastid(atpE)

SKU:CSB-CF417080CXT

Regular price ¥253,500 JPY
Regular price Sale price ¥253,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cuscuta reflexa (Southern Asian dodder)

Uniprot NO.:A7M953

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Protein Names:Recommended name: ATP synthase subunit C, plastid Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein

Gene Names:Name:atpE Synonyms:atpH

Expression Region:1-81

Sequence Info:full length protein

View full details