Gene Bio Systems
Recombinant Cupriavidus taiwanensis Probable intracellular septation protein A (RALTA_A1457)
Recombinant Cupriavidus taiwanensis Probable intracellular septation protein A (RALTA_A1457)
SKU:CSB-CF463341DZS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424))
Uniprot NO.:B3R523
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFLFDLFPVILFFAAFKLADIYTATAVAIGATVLQIGWVWFRHRKVEPMQWVSLLIIAV FGGATLVLHNETFIKWKPTVLYWLFAAALLGSVLVWRKNLIRAMMEKQVSLPDPVWARLN LAWAGFFAAMGVLNLYVAYQFSTEAWVNFKLFGSMGLMLVFIVAQSVWLSRHMPENTQD
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:RALTA_A1457
Expression Region:1-179
Sequence Info:full length protein
