Recombinant Cupressus arizonica Pectate lyase 1

SKU: CSB-EP871029COADd1

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: Q9SCG9

Gene Names: N/A

Organism: Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)

AA Sequence: ADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA

Expression Region: 22-367aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

MW: 65.1 kDa

Alternative Name(s): Major pollen allergen Cup a 1 Allergen: Cup a 1

Relevance: Has pectate lyase activity.

Reference: "Molecular cloning of major allergen from Cupressus arizonica pollen: Cup a 1."Aceituno E., Del Pozo V., Minguez A., Arrieta I., Cortegano I., Cardaba B., Gallardo S., Rojo M., Palomino P., Lahoz C.Clin. Exp. Allergy 30:1750-1758(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.