
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ctenocephalides felis (Cat flea)
Uniprot NO.:P29872
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNTWMNFNLQNSNSPLMEQLMFFHNHSMLIILLITILVGYIMSSLLYNKLYNRYLLESQN VEIIWTILPAFMLIFIALPSLRLLYLLDDSNSPLISLKAIGHQWYWSYEYTDFNNISFDS YMIPSNELNLNSFRLLDVDNRIILPINSQIRILITATDVLHSWTIPSLGIKIDATPGRLN QSNFMMNRPGLYFGQCSEICGANHSFMPIVIESILINSFIKWISSNS
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:COII
Expression Region:1-227
Sequence Info:full length protein
You may also like
-
Recombinant Cat Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- ¥233,500 JPY
- Sale price
- ¥233,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(COXII)
- Regular price
- ¥230,800 JPY
- Sale price
- ¥230,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(COX2)
- Regular price
- ¥237,800 JPY
- Sale price
- ¥237,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 2(COII)
- Regular price
- ¥233,400 JPY
- Sale price
- ¥233,400 JPY
- Regular price
-
- Unit price
- per
Sold out