Gene Bio Systems
Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11(S11)
Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11(S11)
SKU:CSB-CF737603CFAT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)
Uniprot NO.:Q65YU5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:IEDFDTHYTKKIREFLLFIIHTSCTMVAFIIGNLAMTRPRRTHHNTITAPDETIHDDILL PPAYKSLASAPALGIKMV
Protein Names:Recommended name: Uncharacterized protein VP11
Gene Names:Name:S11
Expression Region:24-101
Sequence Info:full length protein
