Skip to product information
1 of 1

Gene Bio Systems

Recombinant Crucihimalaya wallichii Chloroplast envelope membrane protein(cemA)

Recombinant Crucihimalaya wallichii Chloroplast envelope membrane protein(cemA)

SKU:CSB-CF390601CXN

Regular price ¥282,100 JPY
Regular price Sale price ¥282,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Crucihimalaya wallichii (Rock-cress) (Arabidopsis campestris)

Uniprot NO.:A4QKU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWAKEKLFILNSWVQEFLYNLSDTIKAFSILLVTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND

Protein Names:Recommended name: Chloroplast envelope membrane protein

Gene Names:Name:cemA Synonyms:ycf10

Expression Region:1-229

Sequence Info:full length protein

View full details