Recombinant Cricetulus griseus Vesicle-trafficking protein SEC22b(Sec22b)

SKU: CSB-CF020945DXU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Uniprot NO.:O08595

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLGAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

Protein Names:Recommended name: Vesicle-trafficking protein SEC22b Alternative name(s): ER-Golgi SNARE of 24 kDa Short name= ERS-24 Short name= ERS24 SEC22 vesicle-trafficking protein homolog B

Gene Names:Name:Sec22b Synonyms:Ers-24

Expression Region:2-215

Sequence Info:full length protein