Skip to product information
1 of 1

Gene Bio Systems

Recombinant Crab-eating macaque Interleukin-4(IL4)

Recombinant Crab-eating macaque Interleukin-4(IL4)

SKU:CSB-YP301281MOV

Regular price ¥204,200 JPY
Regular price Sale price ¥204,200 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Immunology

Target / Protein: IL4

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Delivery time: 3-7 business days

Uniprot ID: P79339

AA Sequence: HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Tag info: N-terminal 6xHis-tagged

Expression Region: 25-153aa

Protein length: Full Length of Mature Protein

MW: 16.9 kDa

Alternative Name(s): B-cell stimulatory factor 1

Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Reference: "Cloning of interleukin-4 delta2 splice variant (IL-4delta2) in chimpanzee and cynomolgus macaque: phylogenetic analysis of delta2 splice variant appearance, and implications for the study of IL-4-driven immune processes."Gautherot I., Burdin N., Seguin D., Aujame L., Sodoyer R.Immunogenetics 54:635-644(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details