Gene Bio Systems
Recombinant Coturnix coturnix japonica Anti-apoptotic protein NR13(NR13)
Recombinant Coturnix coturnix japonica Anti-apoptotic protein NR13(NR13)
SKU:CSB-CF845855DXJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coturnix coturnix japonica (Japanese quail) (Coturnix japonica)
Uniprot NO.:Q90343
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAE PREAAALLRKVAAQLETDGGLNWGRLLALVVFAGTLAAALAESACEEGPSRLAAALTAYL AEEQGEWMEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Protein Names:Recommended name: Anti-apoptotic protein NR13 Alternative name(s): Apoptosis regulator Nr-13
Gene Names:Name:NR13
Expression Region:1-177
Sequence Info:full length protein
