Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum UPF0059 membrane protein Cgl1469-cg1660(Cgl1469, cg1660)

Recombinant Corynebacterium glutamicum UPF0059 membrane protein Cgl1469-cg1660(Cgl1469, cg1660)

SKU:CSB-CF822854DWY

Regular price ¥271,600 JPY
Regular price Sale price ¥271,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Uniprot NO.:Q8NQG6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPFLQISLLSIGVAADAFACSVVRGTAIQVNLFKRALVLAGIFGVFQAAMPLIGWFIGRF FAGITFIAEIDHWIAFALLGIVGTKMIWDAFQPEDDETIVDDGRVQFRPAIILGLATSID ALAVGMGLAFVEVSILKVALSMGSITFALSLAGAWIGHHGGGKFGKWATILGGIILIGIG ANIVYEHLSA

Protein Names:Recommended name: UPF0059 membrane protein Cgl1469/cg1660

Gene Names:Ordered Locus Names:Cgl1469, cg1660

Expression Region:1-190

Sequence Info:full length protein

View full details