Gene Bio Systems
Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017-cg2211(Cgl2017, cg2211)
Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017-cg2211(Cgl2017, cg2211)
SKU:CSB-CF850942DWY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Uniprot NO.:Q8NP09
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVE TIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTD SQLRSVNIEPSRVAHLRAADSAKELDN
Protein Names:Recommended name: Uncharacterized membrane protein Cgl2017/cg2211 Short name= P20
Gene Names:Ordered Locus Names:Cgl2017, cg2211
Expression Region:1-147
Sequence Info:full length protein
