Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium aurimucosum UPF0233 membrane protein cauri_0028 (cauri_0028)

Recombinant Corynebacterium aurimucosum UPF0233 membrane protein cauri_0028 (cauri_0028)

SKU:CSB-CF503633DWX

Regular price ¥255,700 JPY
Regular price Sale price ¥255,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) (Corynebacterium nigricans)

Uniprot NO.:C3PE99

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKITTEGSALPQSSSSATNRTPVKINSEGTPKWYIAIMLGLMLLGLLWLVVNYLAGE SIPFMQELGPWNYGIGFGLAIIGLLMTMGWR

Protein Names:Recommended name: UPF0233 membrane protein cauri_0028

Gene Names:Ordered Locus Names:cauri_0028

Expression Region:1-91

Sequence Info:full length protein

View full details