Skip to product information
1 of 1

GeneBio Systems

Recombinant Conus radiatus Iota-conotoxin-like r11c

Recombinant Conus radiatus Iota-conotoxin-like r11c

SKU:Q7Z096

Regular price ¥149,500 JPY
Regular price Sale price ¥149,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q7Z096

Gene Names: N/A

Alternative Name(s): R11.4

Abbreviation: Recombinant Conus radiatus Iota-conotoxin-like r11c protein

Organism: Conus radiatus (Rayed cone)

Source: Yeast

Expression Region: 37-79aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-sumostar-tagged

Target Protein Sequence: GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT

MW: 17.7 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.

Reference:

Function:

View full details