Skip to product information
1 of 1

Gene Bio Systems

Recombinant Colorado tick fever virus Uncharacterized protein VP12

Recombinant Colorado tick fever virus Uncharacterized protein VP12

SKU:CSB-CF731312DVJ

Regular price ¥269,200 JPY
Regular price Sale price ¥269,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Colorado tick fever virus (strain USA/Florio N-7180) (CTFV)

Uniprot NO.:Q66262

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KLYEFYKNNETARNTSVAGFLKRHEVAVNVIVEFSFDILFFLCGLLGFELSPTARRLIFR RTASAEKADTVELEHVSSRRRNDSRDDSTVRNVSKTSPLASQRSRDHFDGDPREPAPPAY SPADFYPPPASPHICETPLSTRVAPSAPSASLFTAGGIGLP

Protein Names:Recommended name: Uncharacterized protein VP12

Gene Names:

Expression Region:25-185

Sequence Info:full length protein

View full details