Skip to product information
1 of 1

GeneBio Systems

Recombinant Collariella virescens LPMO lytic polysaccharide monooxygenase (aa9)

Recombinant Collariella virescens LPMO lytic polysaccharide monooxygenase (aa9)

SKU:A0A223GEC9

Regular price ¥180,100 JPY
Regular price Sale price ¥180,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: A0A223GEC9

Gene Names: aa9

Alternative Name(s):

Abbreviation: Recombinant Collariella virescens aa9 protein

Organism: Collariella virescens

Source: Yeast

Expression Region: 23-274aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: HTRMFSVWVNGVDQGDGQNVYIRTPPNTDPIKDLASPALACNVKGGEPVPQFVSASAGDKLTFEWYRVKRGDDIIDPSHSGPITTWIAAFTSPTMDGTGPVWSKIHEEGYDASTKSWAVDKLIANKGMWDFTLPSQLKPGKYMLRQEIVAHHESDATFDKNPKRGAQFYPSCVQVDVKGVGGDAVPDQAFDFNKGYKYSDPGIAFDMYTDFDSYPIPGPPVWDAQDEGCCFIDGVDTTSVKEVVKQIICVLK

MW: 29.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference: "Structural and electronic determinants of lytic polysaccharide monooxygenase reactivity on polysaccharide substrates." Simmons TJ, Frandsen KEH, Ciano L, Tryfona T, Lenfant N, Poulsen JC, Wilson LFL, Tandrup T, Tovborg M, Schnorr K, Johansen KS, Henrissat B, Walton PH, Lo Leggio L, Dupree P. Nat Commun 8 1064 (2017)

Function:

View full details