
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coccidioides immitis (strain RS) (Valley fever fungus)
Uniprot NO.:Q1DME3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:STSAGSTLGDRIGQMYRAHLSKHPFLLFGLPFLSLMVAGSFVLTPATALRYERHDRKVQQ VSQQEALALGIKGPDGDGENDIKMNPRRRVLGSEKEEYYRLMAKDLDNWEQKRVQRWKGE PDGRLS
Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial
Gene Names:Name:COX16 ORF Names:CIMG_08520
Expression Region:12-137
Sequence Info:full length protein
You may also like
-
Recombinant Paracoccidioides brasiliensis Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
- Regular price
- ¥168,500 JPY
- Sale price
- ¥168,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)
- Regular price
- ¥169,600 JPY
- Sale price
- ¥169,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Coccidioides immitis Protein GET1(GET1)
- Regular price
- ¥180,400 JPY
- Sale price
- ¥180,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Phaeosphaeria nodorum Cytochrome c oxidase assembly protein COX16, mitochondrial(COX16)
- Regular price
- ¥167,600 JPY
- Sale price
- ¥167,600 JPY
- Regular price
-
- Unit price
- per
Sold out