Gene Bio Systems
Recombinant Clostridium sticklandii Cobalt transport protein CbiM(cbiM)
Recombinant Clostridium sticklandii Cobalt transport protein CbiM(cbiM)
SKU:CSB-CF516744DUS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654)
Uniprot NO.:E3PSD4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGFLPPLWAAIWSVISLPFIVGGFSKIKKITDESPNMKLLLGLVGAFVFVLSALKL PSVTGSTSHPTGVGLGTIIFGPLPMAVIGLIVLIFQALLLAHGGITTLGANVFSMAIVGP FAGYFIFKAIKDKNRSLAVFLAAMLADLITYIVTSLQLALAHPDAVNGIVGSFTKFMGIF AITQIPLAIGEGILTLIVYNLLVEYQKEGGFNLEKTH
Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:CLOST_1668
Expression Region:25-241
Sequence Info:full length protein
