Gene Bio Systems
Recombinant Clostridium phytofermentans ATP synthase subunit c(atpE)
Recombinant Clostridium phytofermentans ATP synthase subunit c(atpE)
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Uniprot NO.:A9KK97
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISNEAFVLGCSAIGAGLAMIAGIGPGIGQGIAAGHGAAAVGRNPGARGNIMSTMLLGQA VAETTGLYGFAVAIILLFANPLLGKL
Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Gene Names:Name:atpE Ordered Locus Names:Cphy_3741
Expression Region:1-86
Sequence Info:full length protein