Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium perfringens UPF0059 membrane protein CPF_0516(CPF_0516)

Recombinant Clostridium perfringens UPF0059 membrane protein CPF_0516(CPF_0516)

SKU:CSB-CF610757CAAN

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Uniprot NO.:Q0TTS0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSILSIVLTGFGLAMDAFAVSVAKGITLTRVKAKDALKVALFFGGFQALMPLIGWGAGRY FADYIKAFDHWIAFILLGFIGGKMIFEALKEDDEEKAEVAVSMEVSKNKEREFANMKRKE ELSAKNLTVLAIATSIDALAVGVSFAFLGISIVQTIIIIGIITFVLCFLGVIIGEKLGDI FKNYAEIVGGVILILIGINILLEHTGIIEKLFS

Protein Names:Recommended name: UPF0059 membrane protein CPF_0516

Gene Names:Ordered Locus Names:CPF_0516

Expression Region:1-213

Sequence Info:full length protein

View full details