Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium cellulolyticum UPF0059 membrane protein Ccel_1412 (Ccel_1412)

Recombinant Clostridium cellulolyticum UPF0059 membrane protein Ccel_1412 (Ccel_1412)

SKU:CSB-CF490119DUL

Regular price ¥271,000 JPY
Regular price Sale price ¥271,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)

Uniprot NO.:B8I1G8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLTELILLAIGLSMDASAVSISNSLCIKKIKIKHILQMAVMFAVFQGIMPLIGYYAANS FENVIERFDHWIAFILLVIIGGKMIHESITADEEQDCSLFSLTFKLLLVQAVATSIDALA VGVSLSALNVDILYSITIIGIVTFICCTAAILLANRFGNLLGKRAGIVGGLILVGIGVKI FVQHMFFGG

Protein Names:Recommended name: UPF0059 membrane protein Ccel_1412

Gene Names:Ordered Locus Names:Ccel_1412

Expression Region:1-189

Sequence Info:full length protein

View full details