Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium cellulolyticum Protein CrcB homolog(crcB)

Recombinant Clostridium cellulolyticum Protein CrcB homolog(crcB)

SKU:CSB-CF491397DUL

Regular price ¥264,000 JPY
Regular price Sale price ¥264,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)

Uniprot NO.:B8I378

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKEMINVVAVGTGGFVGAASRYFISTLVNKLNTSGFPIATLIINILGSFLIGLLTQLLMS LCPDNKKLNLFLTTGILGGFTTFSTFSLETVNLFQGGKAVFGVVNIVLSIAFCLTGVVLG KMLAKTIASM

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:Ccel_1873

Expression Region:1-130

Sequence Info:full length protein

View full details