Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium botulinum UPF0059 membrane protein CBO0394 (CBO0394)

Recombinant Clostridium botulinum UPF0059 membrane protein CBO0394 (CBO0394)

SKU:CSB-CF401243CWV

Regular price ¥270,700 JPY
Regular price Sale price ¥270,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Uniprot NO.:A5HYT8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVQELFLLALAISLDAFGVILCIGINKGITLKSSMIFVFSFGFFQFFLSFLGGYIGTIF NKYIVPIPTIVGGLIIIIVGILMITEGFKEKEESIFLNKIMYLILGVSVSIDALVIGFTT LSYINNLFYLFMSSLFMGLIATIICSLGIILSKYIKKISIISSYADYIGGIILILFGLKM LFF

Protein Names:Recommended name: UPF0059 membrane protein CBO0394

Gene Names:Ordered Locus Names:CBO0394

Expression Region:1-183

Sequence Info:full length protein

View full details