Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit(clpP)

Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit(clpP)

SKU:CSB-EP401627CWV

Regular price ¥190,300 JPY
Regular price Sale price ¥190,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: A5I6W1

Gene Names: clpP

Organism: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

AA Sequence: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK

Expression Region: 1-194aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 37.5 kDa

Alternative Name(s): Endopeptidase Clp

Relevance: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec; and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).

Reference: "Analysis of the neurotoxin complex genes in Clostridium botulinum A1-A4 and B1 strains: BoNT/A3, /Ba4 and /B1 clusters are located within plasmids."Smith T.J., Hill K.K., Foley B.T., Detter J.C., Munk A.C., Bruce D.C., Doggett N.A., Smith L.A., Marks J.D., Xie G., Brettin T.S. PLoS ONE 2:E1271-E1271(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details