Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium beijerinckii UPF0060 membrane protein Cbei_2176 (Cbei_2176)

Recombinant Clostridium beijerinckii UPF0060 membrane protein Cbei_2176 (Cbei_2176)

SKU:CSB-CF406466DUC

Regular price ¥260,600 JPY
Regular price Sale price ¥260,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum)

Uniprot NO.:A6LVG3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIIKSILYFILAGIFEIGGGYLIWIWLRDGKSYLYGVIGAVILILYGIIPTLQPSNADF GKVYAAYGGIFIVMSILWGWKIDNIVPDKFDLIGGCIALVGVIVIMYAPRG

Protein Names:Recommended name: UPF0060 membrane protein Cbei_2176

Gene Names:Ordered Locus Names:Cbei_2176

Expression Region:1-111

Sequence Info:full length protein

View full details