Skip to product information
1 of 1

Gene Bio Systems

Recombinant Citrobacter koseri UPF0299 membrane protein CKO_00648 (CKO_00648)

Recombinant Citrobacter koseri UPF0299 membrane protein CKO_00648 (CKO_00648)

SKU:CSB-CF424219CWS

Regular price ¥264,500 JPY
Regular price Sale price ¥264,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Uniprot NO.:A8AE89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKSLNIIWQYLRAFVLIYACLYAGIFIASLLPITIPGSIIGMLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFLVVSWSSHIVHG ERKVLGQKGSKK

Protein Names:Recommended name: UPF0299 membrane protein CKO_00648

Gene Names:Ordered Locus Names:CKO_00648

Expression Region:1-132

Sequence Info:full length protein

View full details