Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chromohalobacter salexigens UPF0059 membrane protein Csal_0169(Csal_0169)

Recombinant Chromohalobacter salexigens UPF0059 membrane protein Csal_0169(Csal_0169)

SKU:CSB-CF632103CAAK

Regular price ¥271,100 JPY
Regular price Sale price ¥271,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

Uniprot NO.:Q1R175

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPASLILLAFAMSTDAFAASIGRGAELRKVRLLSALRIGAVFGVVEAIMPLLGWALGHV AMRFVSGVDHWIAFVMLALLGGHMIWAGVKKEDCAAIKAAETQPENRSIWLIAFTALATS IDAMAVGITLALTDINIIAASVAIGLATALMVTLGTLLGRAIGTIVGKWAEILGGLILIG IGIAVLYEHLAGLASA

Protein Names:Recommended name: UPF0059 membrane protein Csal_0169

Gene Names:Ordered Locus Names:Csal_0169

Expression Region:1-196

Sequence Info:full length protein

View full details