Recombinant Chromobacterium violaceum UPF0060 membrane protein CV_3485(CV_3485)

SKU: CSB-CF762934CKA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Uniprot NO.:Q7NSE1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEWLTGLPRVAGLFVLTALAEIVGCYLPWLVLREGRSLWLLAPTTLALALFAWLLTLHPA AAGRTYAAYGGVYVTVAIAWLWLVDGVRPDRWDALGCALALAGMAVIMLAPRS

Protein Names:Recommended name: UPF0060 membrane protein CV_3485

Gene Names:Ordered Locus Names:CV_3485

Expression Region:1-113

Sequence Info:full length protein