Gene Bio Systems
Recombinant Chromobacterium violaceum Glycerol-3-phosphate acyltransferase(plsY)
Recombinant Chromobacterium violaceum Glycerol-3-phosphate acyltransferase(plsY)
SKU:CSB-CF749083CKA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Uniprot NO.:Q7NRU2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTTAFAFVLAAYLIGSLSFAVIVSKAMGMADPRSYGSGNPGATNVLRTGKKLAAALTLL GDGAKGWVAVALASWLGPRYGLGEQGIALCALAVLFGHMWPVFFGFKGGKGVATAVGILF GINPWLALAALATWLFMAFVVKISSLSAIVACVLAPVYAFFILGPHSVYFGTCIIIAIVV VHRHKSNLIKLMTGQEDKIGNKGDAG
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:CV_3688
Expression Region:1-206
Sequence Info:full length protein
