Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlorocebus aethiops CD209 antigen(CD209)

Recombinant Chlorocebus aethiops CD209 antigen(CD209)

SKU:CSB-CF004899DSU

Regular price ¥305,000 JPY
Regular price Sale price ¥305,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Uniprot NO.:P60883

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSQLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPTPTTPNPPPE

Protein Names:Recommended name: CD209 antigen Alternative name(s): Dendritic cell-specific ICAM-3-grabbing non-integrin 1 Short name= DC-SIGN1 CD_antigen= CD209

Gene Names:Name:CD209

Expression Region:1-381

Sequence Info:full length protein

View full details