Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlorobium tepidum Cytochrome c(pscC)

Recombinant Chlorobium tepidum Cytochrome c(pscC)

SKU:CSB-CF006328DST

Regular price ¥277,100 JPY
Regular price Sale price ¥277,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Uniprot NO.:O07091

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKNSNGKLIALAVGGAVLMGALFFSVSFLTGYIPAPNHSAILTPLRSFMGWFLLIFCAS IIIMGLGKMSSAISDKWFLSFPLSIFVIVMVMFLSLRVYWEKGRTTTVDGKYIRTTAELK EFLNKPAATSDVPPAPAGFDFDAAKKLVDVRCNKCHTLDSVADLFRTKYKKTGQVNLIVK RMQGFPGSGISDDDAKTIGIWLHEKF

Protein Names:Recommended name: Cytochrome c Alternative name(s): Photosystem P840 reaction center cytochrome c-551

Gene Names:Name:pscC Ordered Locus Names:CT1639

Expression Region:1-206

Sequence Info:full length protein

View full details