Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydophila abortus Sulfur-rich protein(srp)

Recombinant Chlamydophila abortus Sulfur-rich protein(srp)

SKU:CSB-CF686485CJA

Regular price ¥267,300 JPY
Regular price Sale price ¥267,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydophila abortus (strain S26/3)

Uniprot NO.:Q5L6T1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRA FQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEK WRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS

Protein Names:Recommended name: Sulfur-rich protein

Gene Names:Name:srp Ordered Locus Names:CAB182

Expression Region:1-160

Sequence Info:full length protein

View full details