Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit V, chloroplastic(PSAG)

Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit V, chloroplastic(PSAG)

SKU:CSB-CF319665DSJ

Regular price ¥257,900 JPY
Regular price Sale price ¥257,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydomonas reinhardtii (Chlamydomonas smithii)

Uniprot NO.:P14224

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ALDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATN DPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS

Protein Names:Recommended name: Photosystem I reaction center subunit V, chloroplastic Alternative name(s): Light-harvesting complex I 10 kDa protein P35 protein PSI-G

Gene Names:Name:PSAG

Expression Region:31-126

Sequence Info:full length protein

View full details