Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydomonas reinhardtii Mitochondrial cardiolipin hydrolase (CHLREDRAFT_190403)

Recombinant Chlamydomonas reinhardtii Mitochondrial cardiolipin hydrolase (CHLREDRAFT_190403)

SKU:CSB-CF018149DSJ

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlamydomonas reinhardtii (Chlamydomonas smithii)

Uniprot NO.:A8IW99

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGCASSKEEVALTPLSDVNAAKEVADLKAQVDQLKRQLASAGQSAAPAAAGAVKGGVVETLFFPDEKLPCRNNRRPGGCKRQHCEYSHTPTSLSRFLDYLGSATRTLDICVFTITNDDISDVVLELHNKGVRVRIISDNDQAHTQGSDIDKFRQAGIAVRQDKTAAHMHHKFAIIDGRLLLNGSFNWTRQAVTANNENVTVLSDPKLIASFQQQFDKLWDMFK

Protein Names:Recommended name: Mitochondrial cardiolipin hydrolase EC= 3.1.4.- Alternative name(s): Phospholipase D6 homolog Short name= PLD 6

Gene Names:ORF Names:CHLREDRAFT_190403

Expression Region:1-223

Sequence Info:full length protein

View full details