Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Transmembrane protein 208(TMEM208)

Recombinant Chicken Transmembrane protein 208(TMEM208)

SKU:CSB-CF023802CH

Regular price ¥272,300 JPY
Regular price Sale price ¥272,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZK32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPKGKAGTKGKKQIFEENRETLRFYLRIILGASAVYAAVNLVVFYPAASAWTWLAFAFS SAVYGASYRSMSSMARPAFADDGSLADGGIDLNMEQGWQSECPHPHEPRHLKDVILLTAM VQVLSCFSLYVWYFWLLAPGRALYLLWVNILGPWFTAESSAPGQEPNEKKQRRTGTPPE

Protein Names:Recommended name: Transmembrane protein 208

Gene Names:Name:TMEM208 ORF Names:RCJMB04_13i12

Expression Region:1-179

Sequence Info:full length protein

View full details