Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken T-cell-specific surface glycoprotein CD28 homolog(CD28)

Recombinant Chicken T-cell-specific surface glycoprotein CD28 homolog(CD28)

SKU:CSB-CF004913CH

Regular price ¥273,100 JPY
Regular price Sale price ¥273,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:P31043

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADVTENKILVAQRPLLIVANRTATLVCNYTYNGTGKEFRASLHKGTDSAVEVCFISWNMTKINSNSNKEFNCRGIHDKDKVIFNLWNMSASQTDIYFCKIEAMYPPPYVYNEKSNGTVIHVRETPIQTQEPESATSYWVMVAVTGLLGFYSMLITAVFIIYRQKSKRNRYRQSDYMNMTPRHPPHQKNKGYPSYAPTRDYTAYRSWQP

Protein Names:Recommended name: T-cell-specific surface glycoprotein CD28 homolog Alternative name(s): CHT28

Gene Names:Name:CD28

Expression Region:14-221

Sequence Info:full length protein

View full details