Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Riboflavin-binding protein,partial

Recombinant Chicken Riboflavin-binding protein,partial

SKU:CSB-YP360879CH

Regular price ¥181,200 JPY
Regular price Sale price ¥181,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P02752

Gene Names: N/A

Organism: Gallus gallus (Chicken)

AA Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK

Expression Region: 18-225aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 25.8 kDa

Alternative Name(s):

Relevance: Required for the transport of riboflavin to the developing oocyte.

Reference: Chicken riboflavin-binding protein. cDNA sequence and homology with milk folate-binding protein.Zheng D.B., Lim H.M., Pene J.J., White H.B. IIIJ. Biol. Chem. 263:11126-11129(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details