Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Protein NEF1(NEF1)

Recombinant Chicken Protein NEF1(NEF1)

SKU:CSB-CF758840CH

Regular price ¥247,400 JPY
Regular price Sale price ¥247,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q76LT9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV

Protein Names:Recommended name: Protein NEF1

Gene Names:Name:NEF1 ORF Names:RCJMB04_19i7

Expression Region:1-79

Sequence Info:full length protein

View full details