Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Olfactory receptor-like protein COR8(COR8)

Recombinant Chicken Olfactory receptor-like protein COR8(COR8)

SKU:CSB-CF850669CH

Regular price ¥268,400 JPY
Regular price Sale price ¥268,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q98913

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VAICNPLLYTISMPKSLCMKLVAGSYLGGVLNSLTQTCCLLPLPFCGPNVINHYFCDTNP LLKLTCSDGRLNELLLVTFNGTISMTVLLIIVISYVYILVSILSIRSARGRHKAFSTCAS HLLTVTLFYVPAGLSHMQPGSKYSLDMEKVTAVFYTLLV

Protein Names:Recommended name: Olfactory receptor-like protein COR8

Gene Names:Name:COR8

Expression Region:1-159

Sequence Info:full length protein

View full details