Gene Bio Systems
Recombinant Chicken Integral membrane protein 2B(ITM2B)
Recombinant Chicken Integral membrane protein 2B(ITM2B)
SKU:CSB-CF011904CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:O42204
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ
Protein Names:Recommended name: Integral membrane protein 2B Alternative name(s): Transmembrane protein E3-16
Gene Names:Name:ITM2B
Expression Region:1-262
Sequence Info:full length protein
