Gene Bio Systems
Recombinant Chicken Heme transporter HRG1(SLC48A1)
Recombinant Chicken Heme transporter HRG1(SLC48A1)
SKU:CSB-CF726476CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q5ZHU0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVSRALALRLAYAAAGALMGFSAFFTWSLAPAFRQPATAAAGGLSGVLALWALITHVMY VQDYWRTWLKGLRFFLFIGILFSALSVVGFCTFLVLAITQHQSLTDPRSYYLSCVWSFIS LKWAFLLSLYAYRYRNEFADISILSDF
Protein Names:Recommended name: Heme transporter HRG1 Alternative name(s): Heme-responsive gene 1 protein homolog Short name= HRG-1 Solute carrier family 48 member 1
Gene Names:Name:SLC48A1 Synonyms:HRG1 ORF Names:RCJMB04_33e14
Expression Region:1-147
Sequence Info:full length protein
