Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken E3 ubiquitin-protein ligase RNF185(RNF185)

Recombinant Chicken E3 ubiquitin-protein ligase RNF185(RNF185)

SKU:CSB-CF730488CH

Regular price ¥275,100 JPY
Regular price Sale price ¥275,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZIR9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASKGPTTSASTKSSSTGGTSGSSSSNGAGDNTNQDNTFECNICLDTAKDAVISLCGHLF CWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPE NRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLF LFVALVIMFWLLIA

Protein Names:Recommended name: E3 ubiquitin-protein ligase RNF185 EC= 6.3.2.- Alternative name(s): RING finger protein 185

Gene Names:Name:RNF185 ORF Names:RCJMB04_23p11

Expression Region:1-194

Sequence Info:full length protein

View full details