Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Anosmin-1(ANOS1),partial

Recombinant Chicken Anosmin-1(ANOS1),partial

SKU:CSB-EP011978CH

Regular price ¥190,700 JPY
Regular price Sale price ¥190,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P33005

Gene Names: ANOS1

Organism: Gallus gallus (Chicken)

AA Sequence: SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP

Expression Region: 22-281aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 33.2 kDa

Alternative Name(s): Kallmann syndrome protein homolog

Relevance: May be an adhesion-like molecule with anti-protease activity.

Reference: "Expression of the KAL gene in multiple neuronal sites during chicken development."Legouis R., Lievre C.A., Leibovici M., Lapointe F., Petit C.Proc. Natl. Acad. Sci. U.S.A. 90:2461-2465(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details