Recombinant Chaetomium globosum Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU: CSB-CF643156CHI

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Uniprot NO.:Q2HDV5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATRRIISQEKTLLEKDDSIGSSPAADEKSNIAPAVPTSVIMKLLAFTLGMIVIPIGSYF ATVDSVFNGNSTYAGALAAIMANVVLIGYIFVAMAEDQSDQQEGGGPGDGKKDR

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 ORF Names:CHGG_01599

Expression Region:1-114

Sequence Info:full length protein