Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog

Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog

SKU:CSB-CF328952CGS

Regular price ¥253,600 JPY
Regular price Sale price ¥253,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)

Uniprot NO.:P30025

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPLRLADAESLLSETSVIPLTPPAQTPEAYYTESDDETAADFLVRMGRQQTAIRRRRRQ TRAAGFVAAFVLVALISGGLGALMCWLAYR

Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): 10 kDa protein

Gene Names:

Expression Region:1-90

Sequence Info:full length protein

View full details