Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC) ,partial

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit(polC) ,partial

SKU:CSB-EP370095DRA

Regular price ¥158,700 JPY
Regular price Sale price ¥158,700 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: polC

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Cenarchaeum symbiosum (strain A)

Delivery time: 3-7 business days

Uniprot ID: A0RYM0

AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA

Tag info: NO-tagged

Expression Region: 287-832aa

Protein length: Partial

MW: 59 kDa

Alternative Name(s):

Relevance: Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase

Reference: "Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum." Hallam S.J., Konstantinidis K.T., Putnam N., Schleper C., Watanabe Y., Sugahara J., Preston C., de la Torre J., Richardson P.M., DeLong E.F. Proc. Natl. Acad. Sci. U.S.A. 103:18296-18301(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details